Xi Qin,Moqin Dun,Dening Pei,Jin Lin,Ln Wng,Peng Zhou,Wenrong Yo,Ying Guo,Xing Li,Lei To,Youxue Ding,Ln Liu,Yong Zhou,Chuncui Ji,Chunming Ro,*,Junzhi Wng,c,**
aNational Institutes for Food and Drug Control,Beijing,100050,China
bSynthetic and Functional Biomolecules Center,Peking University,Beijing,100871,China
cWHO Collaboration Centre for Biologicals Standardization and Evaluation,Beijing,100050,China
Keywords:
Recombinant human interferon α2b
Nanobody
Phage display
Screening
Rapid test
A B S T R A C T
Recombinant human interferon α2b(rhIFNα2b)is widely used as an antiviral therapy agent for the treatment of hepatitis B and hepatitis C.The current identification test for rhIFNα2b is complex.In this study,an anti-rhIFNα2b nanobody was discovered and used for the development of a rapid lateral flow strip for the identification of rhIFNα2b.RhIFNα2b was used to immunize an alpaca,which established a phage nanobody library.After five steps of enrichment,the nanobody I22,which specifically bound rhIFNα2b,was isolated and inserted into the prokaryotic expression vector pET28a.After subsequent purification,the physicochemical properties of the nanobody were determined.A semiquantitative detection and rapid identification assay of rhIFNα2b was developed using this novel nanobody.To develop a rapid test,the nanobody I22 was coupled with a colloidal gold to produce lateral-flow test strips.The developed rhIFNα2b detection assay had a limit of detection of 1 μg/mL.The isolation of I22 and successful construction of a lateral-flow immunochromatographic test strip demonstrated the feasibility of performing ligand-binding assays on a lateral-flow test strip using recombinant protein products.The principle of this novel assay is generally applicable for the rapid testing of other commercial products,with a great potential for routine use in detecting counterfeit recombinant protein products.
Interferon(IFN),a protein with a broad-spectrum antiviral activity in allogeneic cells,was discovered by Isaacs et al.[1,2]in 1957.The recombinant human interferon α2b(rhIFNα2b),which was approved for the first time by the United States Food and Drug Administration in 1986,is one of the earliest recombinant proteins used as a drug worldwide[3].RhIFNα2b is currently used as an antiviral agent for treatment of hepatitis B and hepatitis C.In China,rhIFNα2b has been used since 1994 to treat hepatitis and control the spread of the disease.
The identification test,one of the most important physicochemical tests applied to recombinant proteins,preliminarily determines known proteins.The identification test is required to be highly specific,repeatable,sensitive,simple,and rapid.Part III of the Chinese Pharmacopoeia(2020)states that identification tests are often performed using immunoblotting and dot immunobinding assays[4].These methods require antibody reagents with high specificity and the test should be sensitive and repeatable with the antibody.Most commercial antibodies used for recombinant protein detection are polyclonal or monoclonal.The antibody affinity for the test article varies considerably among different manufacturers and batches,which may affect the reproducibility of the assays.The production of these antibodies is complex and expensive.In addition,monoclonal and polyclonal antibodies must be stored and transported at low temperatures,which hinders the development of rapid testing.Thus,an antibody with high specificity for the target recombinant protein is required to achieve the proper sensitivity and repeatability of the test.Such an antibody would also simplify the identity test,reduce the cost,and increase the efficiency.
In 1993,Hamers-Casterman et al.[5]identified heavy chain antibodies(HCAbs)in camels.Clones of heavy chain variable regions are known as nanobodies or variable domain of heavy chain(VHH)antibodies[6,7].Nanobodies have a molecular weight of 15 kDa(tenth of the weight of normal antibodies),diameter of 2.2 nm,and length of 4.8 nm[8,9].Nanobodies are composed of only one heavy chain variable region and are the smallest fragments that bind antigens in the nature[10].Nanobodies have several advantages over traditional antibodies,including high water solubility,excellent stability[11-13],accurate targeting[14,15],low immunogenicity[16],strong tissue penetration [17],simple production [17],controlled half-life,and high modifiability[18].
Thus,nanobodies are a promising substitute for monoclonal and polyclonal antibodies for the identification of recombinant proteins.In this study,we used rhIFNα2b to immunize an alpaca.After five rounds of immunization,we extracted total ribonucleic acid(RNA)from the alpaca lymphocytes.The VHH region was amplified using nested polymerase chain reaction(PCR)and a phage vector was constructed.Using phage display techniques and five rounds of enrichment,we obtained a new anti-rhIFNα2b nanobody,I22.After preliminary characterization of the physicochemical properties and functions of I22,we used this nanobody in a rapid test of rhIFNα2b.Finally,we developed an enzyme-linked immunosorbent assay(ELISA)method for a semiquantitative rhIFNα2b identification and colloidal gold test strip method for rapid rhIFNα2b identification.
Freund's adjuvant was purchased from Sigma-Aldrich(Beijing,China).A human peripheral blood lymphatic extraction solution was obtained from Solarbio(Beijing,China).Trizol reagent and Pierce electrochemiluminescence(ECL)Western blotting substrate were purchased from Thermo Fisher(Beijing,China).Taq enzymes and plasmid extraction kits were purchased from Promega(Beijing,China).EscherichiacoliTG1,gel extraction kits,endonuclease,and deoxyribonucleic acid(DNA)purification kits were obtained from Invitrogen(Beijing,China).T4 DNA ligase was purchased from NEB(Beijing,China).TMB LIQMID-1 COMPENT was obtained from AMRESCO(Beijing,China).
The national standard for rhIFNα2b was preserved in our department.RhIFNα2b(listed product approved for treatment of hepatitis B,hepatitis C,malignant melanoma,etc.)and other cytokines,including recombinant human granulocyte colonystimulating factor(rhG-CSF,listed product,approved for treatment of chronic severe neutropenia,acute myeloid leukemia,etc.),recombinant human interleukin-2(rhIL-2,listed product,approved for treatment of renal cancer,melanoma,etc.),recombinant human interferon α2a(rhIFNα2α,listed product,approved for treatment of chronic hepatitis C,etc.),and recombinant human interferon α1b(rhIFNα1b,listed product,approved for treatment of chronic hepatitis B,hepatitis C,and hairy cell leukemia),were provided by different manufacturers.
The research on alpaca was performed in accordance with protocols approved by the Institutional Animal Care and Use Committee of Peking University,China.For the first round of immunization,600 μg of rhIFNα2b was dissolved in a mixed solution of 2 mL of phosphate-buffered saline(PBS)and 2 mL of Freund's adjuvant.This mixture was injected into nine different alpaca sites.The second immunization was performed 14 days later,when 300μg of rhIFNα2b was dissolved in a mixed solution of 2 mL of PBS and 2 mL of Freund's adjuvant and injected as described above.The third immunization was identical to the second immunization and was performed two weeks later.The fourth and fifth immunizations were identical to the second immunization.The fourth immunization was performed seven days after the third,while the fifth immunization was performed seven days after the fourth.
After five rounds of immunization,3 mL of blood from the alpaca was collected.The blood was mixed with 3 mL of PBS.6 mL of the human peripheral blood lymphocyte extracting solution was added and centrifuged at 800 relative centrifugal force(RCF)at 4°C for 11 min to collect suspended lymphocytes.The cells were washed with an equal volume of PBS and resuspended in 200μL of PBS.1 mL of Trizol mixed with 240μL of chloroform were added to the cellular suspension.The mixture was centrifuged at 12,000 r/min at 4°C for 15 min.The supernatant was then collected.Isopropanol was added into the supernatant.The mixture was incubated at room temperature for 10 min,and then centrifuged at 12,000 r/min at 4°C for 15 min.The precipitate was retained,washed twice with 750μL of ethanol(75%),and then dried.Finally,the RNA was dissolved in 50μL of diethylpyrocarbonate-treated water.
The extracted RNA was reverse-transcribed into complementary DNA.The VHH fragment was amplified using nested PCR.The firstround PCR primers were VH-LD(5'-CTTGGTGGTCCTGGCTGC-3')and CH2-R(5'-GGTACGTGCTGTTGAACTGTTCC-3')[19],while the second-round PCR primers were VHH-shortR2(5'-CGAGTGCG GCCGCGGGGTCTTCGCTGTGGTGCG-3')and VHH-shortR1(5'-CGAG TGCGGCCGCTTGTGGTTTTGGTGTCTTGGG-3')[19].The amplified VHH fragment and pHEN1 vector were digested with NotI and SfiI.The digested fragments were added to 500μL of a connection system(5μg of pHEN1,1.5μg of VHH,3μL of T4 DNA ligase,50μL of 10× T4 DNA ligase buffer,filled to 500μL with distilled water)at 16°C for 12 h.The linked products were added to 15 competentE.coliTG1 cells(80μL/vial),electrically shocked at 1.8 kV,added into 500μL of a lysogeny broth(LB)culture medium,cultured at 37°C for 2.5 h with shaking at 150 rpm,and cryopreserved.
The TG1 bacterial solution(2.5 mL)was added into a 2×YT culture medium containing 3% glucose.The solution was cultured at 30°C with shaking at 200 r/min until the optical density 600(OD600)reached 0.7.One milliliter of M13K07 was then added.The mixture was incubated at 37°C for 30 min,followed by additional 2 h at 37°C with shaking at 220 r/min.The bacterial cultures were centrifuged at 6,000 r/min for 5 min at 4°C,resuspended in 20 mL of the 2×YT culture medium containing 3% glucose,and cultured overnight at 37°C with shaking at 200 rpm.Bacterial cultures were centrifuged at 2,500 r/min for 20 min at 4°C and the supernatants were collected.The phages were spread on a plate to calculate the colony sizes and titers.
We used a magnetic-bead purification system to screen the phage display library using standard reagents and screening procedures.27μL of a 10 mM N-hydroxysuccinimidobiotin reagent solution(dissolved in dimethylsulfoxide)was added to 1 mL of 2 M rhIFNα2b solution(dissolved in PBS).The reaction was incubated at room temperature for 30 min,followed by dialysis to remove unreacted biotin.Magnetic beads(labeled with streptavidin)were cleaned with 700 μL of PBS and then the labeled rhIFNα2b was added for 30 min.After washing with PBS,the phage library was added.After binding for 30 min,the beads were collected and cleaned with 700μL of PBS,PBS with Tween(PBST),and PBS three times to remove nonspecific binding phages.The bound phages were eluted with a glycine solution(pH 2.2).We used 100μL of 1 M Tris-HCl(pH 8.0)to neutralize the screened eluate.The eluted phages were amplified and used for the next round of screening.This procedure was performed five times in total.Amplifications were performed as described in Section 2.6.
The isolated nanobody sequence was amplified and endmodified by PCR with the primers 5'-CATGCCATGGGCCACCACCACCACCACCACCAGGTGCAGCTCGTGGAG-3'and 5'-CCGCTCGAGTGAGGAGACGGTGACCTG-3',and then inserted into the prokaryotic expression vector pET28a after digestion with NcoI and XhoI restriction enzymes.This vector was then transformed intoE.coliBL21.Positive clones were selected and cultured in the LB medium.When the OD600of each culture reached 0.9,isopropyl β-D-thiogalactoside(IPTG)was added to obtain a final concentration of 0.8 mM.The culture was then transferred to a shaker and incubated at 16°C for 12 h.After incubation,the culture was centrifuged at 7,000 r/min at 4°C for 30 min.The precipitate was resuspended in PBS by sonication at a low temperature,and then recentrifuged.The supernatant was then collected and purified using a nickel column(K10324,TransGen Biotech,Beijing,China).
100 μL of the rhIFNα2b standard and rhIFNα2b products were tested using 96-well plates.The plates were incubated overnight at 4°C,and then sealed with 100 μL of 5% bovine serum albumin(BSA)at 37°C for 1 h.After washing each plate five times with PBST,100 μL of the 100 μg/mL I22 antibody was added,which was then incubated for 1 h at 37°C.After incubation,each plate was washed five times with PBST.100μL of anti-His-HRP antibody(1:1600;MAB050H,R&D Systems,Minneapolis,MN,USA)was then added.The plates were cultured at 37°C for 1 h,and then washed five times with PBST.100 μL of 3,3',5,5'-tetramethyl benzidine(TMB)LIQMID-1 COMPENT(XS12,Cygnus Technologies,Beijing,China)was added into each well,followed by incubation in dark for 30 min.Finally,50μL of 3 M H2SO4was added to terminate the reaction.The OD of each well at 450 nm was then recorded.
After 4%-12% NuPAGE bis-tris gel electrophoresis(NP0321BOX,Invitrogen,Carlsbad,CA,USA),the membranes were transferred and sealed with 5% BSA for 30 min.The membranes were incubated with the primary antibody for 1 h,washed three times with PBST,incubated with the secondary antibody for 1 h,washed with PBST three times,and then developed using a TMB color development solution or ECL solution.
The nanobody was dialyzed with 10 mM of potassium phosphate buffer(pH 7.4)for 2 h.One milliliter of a colloidal gold(particle size:40 nm,concentration:1 mg/mL;HyperCyte,Beijing,China)was dissolved in 10μL of 0.2 M potassium carbonate(pH adjusted to the isoelectric point(pI)of I22+0.2).20μg of the nanobody I22 was then added into the solution dropwise.This solution was mixed,and then allowed to stand for 40 min.90μL of 8% BSA was then added.The reaction was allowed to progress for 40 min.The mixture was then centrifuged at 14,000 r/min for 35 min at 4°C.The precipitate was then washed six to eight times with PBS containing 1% BSA.After washing,the precipitate was redissolved in 600μL of the colloidal gold solution and dried on a gold pad.The rhIFNα2b standard was diluted with PBS to a concentration of 2 mg/mL.The anti-His antibody was diluted with PBS to 1 mg/mL.A nitrocellulose(NC)filter membrane was coated with 10 μL of the rhIFNα2b standard or anti-His antibody and dried at room temperature.On the baseplate,the absorbent paper,NC membrane,gold pad,and sample chromatography pad were laid sequentially(in this order,from top to bottom).These layers were then cut into test strips with the width of 3.6 mm.
After the alpaca was immunized in five rounds with the rhIFNα2b antigen,the serum immune titer in blood samples was measured seven days after each round of immunization.After the third round of immunization,the serum titer was significantly higher than that without immunization(P<0.001;Fig.1A).After the fifth round of immunization,the serum titer was 6.4×104(detection after 1000×predilution).Peripheral blood lymphocytes were used to obtain the phage display library.We extracted RNA from lymphocytes in the serum obtained from the alpaca after the five rounds of immunization(Fig.1B).After reverse transcription,the VHH fragment was amplified using nested PCR(Fig.1C).This fragment was inserted into the pHEN1 vector,and then transferred intoE.coliTG1 to obtain the rhIFNα2b nanobody library.Colony detection and random PCR identification indicated that the library capacity was 2.74×108,while the insertion efficiency was 98%(Fig.1D).These levels were suitable for nanobody screening.
Fig.1.Construction and identification of the phage nanobody library against rhIFNα2b.(A)Detection of serum immune titers after the alpaca was immunized in five rounds with the rhIFNα2b antigen.(B)Extraction of total RNA from lymphocytes.(C)Amplification of the VHH fragment(1 and 2:2 PCR systems with the difference of extracted RNA template).(D)PCR identification of the anti-rhIFNα2b nanobody library(1-20:20 single clones)(M:marker).
The nanobody was displayed on the phage surface using M13K07.The plaque test indicated that the recombinant phage titer was 3.1×1013CFU/mL.Liquid-phase screening was then performed.The magnetic-bead-associated rhIFNα2b protein was mixed with the nanobody phage display library,and then nonspecifically bound recombinant phages were removed by washing.The specifically bound recombinant phage was eluted,amplified,and used for the next round of screening.This procedure was performed five times;the concentrations of coated antigens were 100,50,20,10,and 5μg/mL,respectively.The single clone of the recombinant phage eluted after the last round of screening was selected and amplified as the primary antibody in an ELISA.In the ELISA screening,rhIFNα2b was used as the antigen and anti-His antibody was used as the secondary antibody.After screening 20 single clones with ELISAs,two positive clones were identified(Fig.2A).These two recombinant phages had identical DNA sequences(amino acid sequence:QVQLVESGGGLVQPGGSLRLSCVASG FTFDSATMSWHRQAPGREREFVAMTSGGGMINYANSVKGRFTISRDNA KNTVYLQMDSLKPEDTAVYYCHRLGTFHWGQGTQVTVSSLE;Fig.2B)and were designated I22.I22 was used for Western blotting,where the I22 display phage was used as the primary antibody and the anti-His antibody was used as the secondary antibody(Fig.2C).The nanobody I22 clearly identified rhIFNα2b,as evidenced by the I22 band intensity increase with the rhIFNα2b concentration.
Fig.2.Screening and identification of the nanobody.(A)Two positive clones were identified in 20 single clones with ELISAs.(B)Sequence of the isolated nanobody I22.(C)Verification of I22 by Western blotting(lane 1:1 μg of rhIFNα2b;lane 2:2 μg of rhIFNα2b;lane 3:HSA).
The His-labeled I22 proteins expressed in the supernatant were purified using nickel columns(Fig.3A).A gray scan analysis indicated that the purity of the purified I22 protein was 100.0%.A Quick StartTMBradford Protein Assay Kit(5000202;Bio-Rad,Hercules,CA,USA)was used to detect the protein content and calculate the I22 yield per liter(Fig.3B).This experiment was performed three times.The average yield of I22 per liter of the bacterial solution was 45.7 mg.
Fig.3.Purification and yield of I22.(A)Electrophoresis of purified I22(lanes 1-11:purified I22 and eluted for 1.5,2,2.5,3,3.5,4,4.5,5,5.5,and 6 min,respectively;lane M:marker).(B)Calculation of the I22 concentration using bovine serum albumin(BSA)as the standard(R2=0.98).
The membranes were transferred to an N-terminal sequencer(PPSQ-53A;Shimadzu,Shanghai,China).The sequence of 16 amino acids at the N-terminal was GHHHHHHQVQLVESGG,which was consistent with the theoretical sequence of I22(data not shown).
I22 was treated with dithiothreitol and the equipment was calibrated with a NaI calibration solution.Liquid chromatographymass spectrometer(Xevo G2 Q-TOF;Waters,Milford,MA,USA)was used to carry out an intact mass analysis.The measured molecular weight of I22 was 14,226.80 Da,consistent with the theoretical molecular weight(14,226.77 Da;Fig.4A).
The nanobody I22 was mixed(to yield a final concentration of 100μg/mL)with 1% methylcellulose,8 M urea solution,amphoteric electrolyte 3-10,and two pI markers.After degassing,the solution was injected and analyzed with capillary isoelectric focusing(iCE3;ProteinSimple,Minneapolis,MN,USA).The pI of the I22 protein was 8.20 approximately(Fig.4B).
Fig.4.Physicochemical properties of I22.(A)Deconvoluted mass spectrum of the I22 protein.(B)Capillary isoelectric focusing of I22(anolyte:85% phosphoric acid solution;catholyte:50% NaOH solution;low pI mark=4.98,high pI mark=8.96).
The binding force between I22 and rhIFNα2b was measured with the Octet platform(Octet RED96;Goettingen,Germany).The dissociation curve was shown in Fig.5A,and the equilibrium dissociation constant(KD)value obtained by calculation was 2.06× 10-9M,suggesting that I22 had a high affinity for rhIFNα2b.
The binding specificity between I22 and rhIFNα2b was evaluated using Western blotting.I22 was used to detect the rhIFNα2b standard,rhIFNα2b product,rhIFNα1b product,rhG-CSF product,rhIL-2 product,and rhIFNα2a product(containing protective ingredients,e.g.,human serum albumin(HSA),trehalose,etc.).I22 bound to rhIFNα2b;the binding affinity was not decreased in the presence of the HSA(Fig.5B).I22 also bound to rhIFNα2a,but the binding affinity was lower than that of I22 and rhIFNα2b.
The nanobody I22 and commercial anti-rhIFNα2b monoclonal antibody(ab9386;Abcam,Cambridge,UK)were diluted to 1 μg/mL and used to detect rhIFNα2b in gradient dilutions.Two secondary antibodies,horseradish peroxidase (HRP)-labeled anti-His secondary antibody(R931-25;Thermo,Carlsbad,CA,USA)and HRP-labeled mouse secondary antibody(HS201;TransGen,Beijing,China),were used to compare the sensitivity of I22 and commercial anti-rhIFNα2b monoclonal antibodies,respectively.TMB staining indicated that the limit of detection of I22(at 1μg/mL)was 31.25 ng,while the limit of detection of the anti-rhIFNα2b monoclonal antibody(at 1 μg/mL)was 125 ng(Fig.5C).Thus,the sensitivity of the nanobody I22 was not lower than that of the anti-rhIFNα2b monoclonal antibody.
Fig.5.Affinity between I22 and rhIFNα2b.(A)10 μg/mL rhIFNα2b product combined with 40,20,or 10 μg/mL nanobody I22.The samples were analyzed by following Octet procedures.(B)10 μg of the recombinant protein was detected after electrophoresis and membrane transfer,using 1 μg/mL I22 as the primary antibody(lanes 1-6 are the rhIFNα2b standard,rhIFNα2b product,rhIFNα1b product,rhG-CSF product,rhIL-2 product,and rhIFNα2a product,respectively).(C)Comparison of I22 to a commercial antibody as primary antibodies in Western blotting to detect rhIFN 2b as the antigen(lanes 1-9 are rhIFN 2b standards with masses of 500,250,125,62.5,31.25,15.6,7.8,3.9,and 2 ng,respectively;M:marker).
Preliminary experiments indicated that the rhIFNα2b binding to I22 increased with the I22 concentration in a dose-dependent manner(Fig.6A).The diluted rhIFNα2b standard and rhIFNα2b samples were used to coat 96-well plates.An ELISA was then performed using 100μg/mL I22 as the primary antibody.Over three repetitions of the ELISA,the concentrations of the five rhIFNα2b products were accurately and consistently measured(Figs.6B and C).
Fig.6.Semiquantitative detection of rhIFNα2b with I22.(A)The rhIFNα2b binding to I22 increased with the I22 concentration in a dose-dependent manner.(B)Standard curve for the semiquantitative detection of rhIFNα2b.(C)Statistical analysis of three repeated semiquantitative detection experiments using I22 to detect five rhIFNα2b products(ns:no difference in statistics).
After labeling with the colloidal gold,the I22 nanobody was used to construct the test strips(Fig.7).The absence of red band on the quality control line indicates an invalid test strip.A red band on the quality control line and negative detection line indicate that rhIFNα2b was not detected or that the rhIFNα2b concentration was too low.A red band on the quality control line and absence of a detection line indicate that rhIFNα2b was detected.At an rhIFNα2b concentration of 1μg/mL,the test strip returned a positive result(Figs.8A and S1).The rhIFNα2b limit of detection for the test strip was 1μg/mL,as indicated by multiple tests.The whole test time only takes a few minutes.
Fig.7.Detection principle of the nanobody-coupled colloidal gold test strip.A:the detection area(loading area);G:the area containing the nanobody labeled with the colloidal gold;T:the detection line,coated with the rhIFNα2b standard;and C:the quality control line,coated with the anti-His-labeled antibody.
Fig.8.Rapid detection of rhIFNα2b using the developed paper strips.(A)The limit of detection of the rhIFNα2b test strip was 1 μg/mL.(B)Detection of different rhIFNα2b product ingredients using test strips(1:water;2:powder products of rhIFNα2b from manufacturer A;3:powder products of rhIFN 2b from manufacturer B;4:powder products of rhIFNα2b from manufacturer C;5:liquid products of rhIFNα2b from manufacturer B;6:liquid products of rhIFNα2b from manufacturer C).
Both liquid rhIFNα2b products and dissolved powdered rhIFNα2b products with different compositions were successfully detected with I22colloidal gold test strips(Fig.8B).The blank group was negative.This result indicates that the accessories in rhIFNα2b products did not influence the test results.Thus,these strips can be used for the detection of conventional rhIFNα2b products.
Both solid-phase and liquid-phase screening methods use phages to screen antibody libraries.The operation of solid-phase screening is very simple[20]:the target is specifically bound and nonspecifically bound species are eluted.Liquid-phase screening uses a biotin-magnetic-bead system and streptavidin-target antigen to screen specific target proteins[21].Liquid-phase magneticbead screening has numerous advantages,including specificity,stability,accuracy,and complete exposure of the antigen.Less antigen is required for liquid-phase screening than solid-phase screening[22,23].In this study,we screened the antibody library using liquid-phase screening.
Nanobodies can be expressed using various expression systems[24-28].Nanobodies,which are expressed with a high titer in prokaryotic cells,are inexpensive and simple to express and do not require posttranslational modifications.Therefore,E.coliwas chosen to express the nanobody I22.Protein fragments tagged at the N-or C-terminal[29]are easy to use for the purification and detection of target proteins[30,31].During the preparation of the nanobody I22,pET28a was used to add six His residues at the N-and C-terminals to increase the ease of purification.After the addition of His to these terminals,the nanobody still specifically binds the antigen rhIFNα2b,with not lower binding sensitivity than that of the anti-rhIFNα2b monoclonal antibody.Therefore,the His-labeling simplified the protein purification,increased the efficiency,and improved the I22 detection without reducing the I22 utility.In the comparison of the I22 and commercial antirhIFNα2b antibodies,anti-His and antimouse antibodies were used,respectively,as secondary antibodies.These secondary antibodies were applied in excess to exclude the differences in affinity between the primary-secondary antibody pairs.The dilution ratio of the HRP-labeled anti-His secondary antibody was 1:500,while that of the HRP-labeled mouse secondary antibody was 1:200.(Fig.S2).Thus,the differences in binding affinity were equivalent to the differences in affinity between the primary antibodies to the rhIFNα2b antigen.45.7 mg of I22 was purified from 1 L of the bacterial solution.However,the typical expression level of the hybridoma-generated commercial monoclonal antibody is~25 mg/L.Thus,I22 was not only more economically produced than the commercial monoclonal antibody[32],but also had a substantially larger yield.
RhIFNα2a and rhIFNα2b have lengths of 165 amino acids and differ at only two sites:AA23 is K in the rhIFNα2a sequence and R in the rhIFNα2b sequence,while AA112 is K in the rhIFNα2a sequence and N in the rhIFNα2b sequence.Thus,it is not surprising that the specificity test indicated that I22 binds rhIFNα2a,but with a lower affinity.After neutralization with I22,rhIFNα2b did not affect its biological activity(Fig.S3).It was confirmed that I22 did not block the active site of rhIFNα2b and that I22 was not the neutralizing antibody of rhIFNα2b.
The binding between nanobodies and antigens is more stable than that between traditional antibodies and antigens.Even at high temperatures or extreme pHs,nanobodies stably bind antigens[33,34].Furthermore,nanobodies are not prone to aggregation.The strong binding of nanobodies results from a specific bulge loop structure containing coupled disulfide bonds,which makes the molecule more stable.Thus,the nanobodies were also stable at room temperature.
The rhIFNα2b products currently available in China include injections,injection powders,gels,and pastes.These strips can only be used to evaluate liquids or products in powder format that can be dissolved and applied to the strips,because the product needs to diffuse along the strip by capillary action;gels and pastes do not satisfy this requirement.Across all available injections and injection powders,the lowest rhIFNα2b concentration is 10μg/mL.As the I22 colloidal gold-labeled test strips developed in this study offer a limit of detection of 1μg/mL,these strips would be suitable for the rapid test of available rhIFNα2b products with liquid and powder formats.Owing to the advantages of nanobodies in reagent preservation,production,and cost,the lateral-flow immunochromatography assay using nanobodies has a high potential to replace traditional antibody-based ligandbinding assays for a rapid identification test of recombinant protein therapeutics.
An anti-rhIFNα2b nanobody,I22,was discovered and developed by immune library establishment,molecular screening,expression cloning,and purification.Western blot experiments indicated that I22 is more sensitive,inexpensive,and stable than traditional antibodies.This novel nanobody I22 fits ELISAs,enabling the development of a sensitive and accurate method for semiquantitative detection of rhIFNα2b.The coupling of the nanobody I22 with the colloidal gold provided a lateral-flow immunochromatographic test strip,which enabled a limit of detection of 1μg/mL for rapid identification tests and quality control.Notably,the limit of detection can be further improved through rigorous optimization.The operation time of rhIFNα2b identification was shortened from two days(using an immunoassay)to a few minutes(using I22 colloidal gold test strip),and this test could meet the needs for rapid detection of this family of recombinant protein products on the market and provide a good foundation for improving the efficiency of market counterfeit detection and carrying out rapid detection in an all-round manner in the future.
CRediT author statement
Xi Qin:Methodology,Software,Validation,Formal analysis,Investigation,Data curation,Writing-Original draft preparation,Reviewing and Editing,Visualization,Conceptualization;Maoqin Duan:Methodology,Software,Validation,Formal analysis,Investigation,Data curation,Writing-Original draft preparation;Dening Pei:Methodology,Software,Validation,Formal analysis,Investigation,Data curation,Writing-Original draft preparation;Jian Lin:Methodology,Software,Visualization,Resources;Lan Wang:Methodology,Validation,Formal analysis,Investigation;Peng Zhou:Methodology,Software,Visualization;Wenrong Yao:Methodology,Validation,Formal analysis,Investigation;Ying Guo:Methodology,Validation,Formal analysis;Xiang Li:Methodology,Validation,Formal analysis;Lei Tao:Methodology,Validation,Formal analysis;Youxue Ding:Validation,Formal analysis,Investigation;Lan Liu:Validation,Formal analysis,Investigation;Yong Zhou:Validation,Formal analysis,Investigation;Chuncui Jia:Software,Visualization;Chunming RaoandJunzhiWang: Conceptualization,Investigation,Resources,Supervision.
Declaration of competing interest
The authors declare that there are no conflicts of interest.
Acknowledgments
Financial support was provided by the National Science and Technology Major Project(Grant No.:2015ZX09501008).The fund agency did not participate in the study's design,data collection and analysis,decision to publish,and preparation of the manuscript.We would like to thank Dr.Weijun Ma from the Shanghai Institutes for Biological Sciences for the provision of the vector Rphen1 and helper phages.
Appendix A.Supplementary data
Supplementary data to this article can be found online at https://doi.org/10.1016/j.jpha.2021.07.003.
Journal of Pharmaceutical Analysis2022年2期